PeptideDB

Interleukin-6 fragment (human)

CAS: 145990-81-4 F: C179H281N45O58S W: 4023.48

Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6 fragment (human) coding gene is located on human chromosome 7, with a length of approximately 5 kilobases. Interleukin-6 fragment (human) has potential applications in immune response, acute response, inflammation, tumors, and hematopoiesis[1].
Name Interleukin-6 fragment (human)
CAS 145990-81-4
Sequence Ile-Ile-Thr-Gly-Leu-Leu-Glu-Phe-Glu-Val-Tyr-Leu-Glu-Tyr-Leu-Gln-Asn-Arg-Phe-Glu-Ser-Ser-Glu-Glu-Gln-Ala-Arg-Ala-Val-Gln-Met-Ser-Thr-Lys
Shortening IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK
Formula C179H281N45O58S
Molar Mass 4023.48
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Song M, Kellum J A. Interleukin-6[J]. Critical care medicine, 2005, 33(12): S463-S465.