| Bioactivity | Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6 fragment (human) coding gene is located on human chromosome 7, with a length of approximately 5 kilobases. Interleukin-6 fragment (human) has potential applications in immune response, acute response, inflammation, tumors, and hematopoiesis[1]. |
| Name | Interleukin-6 fragment (human) |
| CAS | 145990-81-4 |
| Sequence | Ile-Ile-Thr-Gly-Leu-Leu-Glu-Phe-Glu-Val-Tyr-Leu-Glu-Tyr-Leu-Gln-Asn-Arg-Phe-Glu-Ser-Ser-Glu-Glu-Gln-Ala-Arg-Ala-Val-Gln-Met-Ser-Thr-Lys |
| Shortening | IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK |
| Formula | C179H281N45O58S |
| Molar Mass | 4023.48 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Song M, Kellum J A. Interleukin-6[J]. Critical care medicine, 2005, 33(12): S463-S465. |
Interleukin-6 fragment (human)
CAS: 145990-81-4 F: C179H281N45O58S W: 4023.48
Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.