| Bioactivity | Insulin cattle (Insulin from bovine pancreas) is a two-chain polypeptide hormone produced in vivo in the pancreatic β cells. Insulin cattle has often been used as growth supplement in culturing cells. | ||||||
| Invitro | Two-chain polypeptide hormone produced by the β-cells of pancreatic islets. The α and β chains are joined by two interchain disulfide bonds. The α chain contains an intrachain disulfide bond. Insulin regulates glucose uptake into muscle and fat cells by recruiting membrane glucose transporter Glut-4 to cell surface. Insulin cattle has often been used as growth supplement in culturing cells at the concentration ranging from 1 to 10 μg/mL of medium. | ||||||
| Name | Insulin(cattle) | ||||||
| CAS | 11070-73-8 | ||||||
| Sequence | Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala. Gly-Ile-Val-Glu-Gln-Cys-Cys-Ala-Ser-Val-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6' | ||||||
| Shortening | FVNQHLCGSHLVEALYLVCGERGFFYTPKA. GIVEQCCASVCSLYQLENYCN (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'-Cys11') | ||||||
| Formula | C254H377N65O75S6 | ||||||
| Molar Mass | 5733.49 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
Insulin(cattle)
CAS: 11070-73-8 F: C254H377N65O75S6 W: 5733.49
Insulin cattle (Insulin from bovine pancreas) is a two-chain polypeptide hormone produced in vivo in the pancreatic β c
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.