PeptideDB

Insulin(cattle)

CAS: 11070-73-8 F: C254H377N65O75S6 W: 5733.49

Insulin cattle (Insulin from bovine pancreas) is a two-chain polypeptide hormone produced in vivo in the pancreatic β c
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Insulin cattle (Insulin from bovine pancreas) is a two-chain polypeptide hormone produced in vivo in the pancreatic β cells. Insulin cattle has often been used as growth supplement in culturing cells.
Invitro Two-chain polypeptide hormone produced by the β-cells of pancreatic islets. The α and β chains are joined by two interchain disulfide bonds. The α chain contains an intrachain disulfide bond. Insulin regulates glucose uptake into muscle and fat cells by recruiting membrane glucose transporter Glut-4 to cell surface. Insulin cattle has often been used as growth supplement in culturing cells at the concentration ranging from 1 to 10 μg/mL of medium.
Name Insulin(cattle)
CAS 11070-73-8
Sequence Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala. Gly-Ile-Val-Glu-Gln-Cys-Cys-Ala-Ser-Val-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'
Shortening FVNQHLCGSHLVEALYLVCGERGFFYTPKA. GIVEQCCASVCSLYQLENYCN (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'-Cys11')
Formula C254H377N65O75S6
Molar Mass 5733.49
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)