PeptideDB

Iberiotoxin

CAS: 129203-60-7 F: C179H274N50O55S7 W: 4230.85

Iberiotoxin is a toxin isolated from Buthus tamulus scorpion venom. Iberiotoxin is a selective high conductance high con
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Iberiotoxin is a toxin isolated from Buthus tamulus scorpion venom. Iberiotoxin is a selective high conductance high conductance Ca2+-activated K+ channel inhibitor with a Kd of ~1 nM. Iberiotoxin does not block other types of voltage-dependent ion channels[1][2][3].
Invitro Iberiotoxin reversibly blocks Ca2+-activated K+ channel in excised membrane patches from bovine aortic smooth muscle. Iberiotoxin acts exclusively at the outer face of the channel and functions with IC50 values of about 250 pM. Iberiotoxin is a partial inhibitor of 125I-charybdotoxin binding in bovine aortic sarcolemmal membrane vesicles (Ki of 250 pM). Iberiotoxin functions as a noncompetitive inhibitor of charybdotoxin binding[1]. Iberiotoxin treatment affects rat mesenchymal stem cells (rMSCs) migration in the absence of platelet lysate (PL) by inducing a decrease in cell migration suggesting that BK channels regulate rMSCs migration in basal conditions. 10 nM of Iberiotoxin abolishes the PL-induced migration effect on MSCs[2].
Name Iberiotoxin
CAS 129203-60-7
Sequence Glp-Phe-Thr-Asp-Val-Asp-Cys-Ser-Val-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Lys-Asp-Leu-Phe-Gly-Val-Asp-Arg-Gly-Lys-Cys-Met-Gly-Lys-Lys-Cys-Arg-Cys-Tyr-Gln (Disulfide bridge:Cys7-Cys28,Cys13-Cys33,Cys17-Cys35)
Shortening {Glp}-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ (Disulfide bridge:Cys7-Cys28,Cys13-Cys33,Cys17-Cys35)
Formula C179H274N50O55S7
Molar Mass 4230.85
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)