| Bioactivity | Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels[1]. |
| Target | IC50: ~60 nM (N-type calcium channel) |
| Name | Huwentoxin XVI |
| CAS | 1600543-88-1 |
| Sequence | Cys-Ile-Gly-Glu-Gly-Val-Pro-Cys-Asp-Glu-Asn-Asp-Pro-Arg-Cys-Cys-Ser-Gly-Leu-Val-Cys-Leu-Lys-Pro-Thr-Leu-His-Gly-Ile-Trp-Tyr-Lys-Ser-Tyr-Tyr-Cys-Tyr-Lys-Lys (Disulfide bridge:Cys1-Cys16;Cys8-Cys21;Cys15-Cys36) |
| Shortening | CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK (Disulfide bridge:Cys1-Cys16;Cys8-Cys21;Cys15-Cys36) |
| Formula | C196H292N50O56S6 |
| Molar Mass | 4437.13 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Meichun Deng, et al. Huwentoxin-XVI, an analgesic, highly reversible mammalian N-type calcium channel antagonist from Chinese tarantula Ornithoctonus huwena. Neuropharmacology. 2014 Apr;79:657-67. |
Huwentoxin XVI
CAS: 1600543-88-1 F: C196H292N50O56S6 W: 4437.13
Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.