| Bioactivity | Huwentoxin XVI TFA, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI TFA has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels[1]. |
| Name | Huwentoxin XVI TFA |
| Sequence | Cys-Ile-Gly-Glu-Gly-Val-Pro-Cys-Asp-Glu-Asn-Asp-Pro-Arg-Cys-Cys-Ser-Gly-Leu-Val-Cys-Leu-Lys-Pro-Thr-Leu-His-Gly-Ile-Trp-Tyr-Lys-Ser-Tyr-Tyr-Cys-Tyr-Lys-Lys (Disulfide bridge:Cys1-Cys16;Cys8-Cys21;Cys15-Cys36) |
| Shortening | CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK (Disulfide bridge:Cys1-Cys16;Cys8-Cys21;Cys15-Cys36) |
| Formula | C198H293F3N50O58S6 |
| Molar Mass | 4551.15 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Huwentoxin XVI TFA
CAS: F: C198H293F3N50O58S6 W: 4551.15
Huwentoxin XVI TFA, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~6
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.