| Bioactivity | Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. Huwentoxin I inhibits sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons with IC50 values of 66.1 and 4.80 nM, respectively[1]. |
| Name | Huwentoxin I |
| CAS | 769973-37-7 |
| Sequence | Ala-Cys-Lys-Gly-Val-Phe-Asp-Ala-Cys-Thr-Pro-Gly-Lys-Asn-Glu-Cys-Cys-Pro-Asn-Arg-Val-Cys-Ser-Asp-Lys-His-Lys-Trp-Cys-Lys-Trp-Lys-Leu (Disulfide bridge: Cys2-Cys17; Cys9-Cys22; Cys16-Cys29) |
| Shortening | ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL (Disulfide bridge: Cys2-Cys17; Cys9-Cys22; Cys16-Cys29) |
| Formula | C161H246N48O44S6 |
| Molar Mass | 3750.36 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Wang M, et al. The effects of huwentoxin-I on the voltage-gated sodium channels of rat hippocampal and cockroach dorsal unpaired median neurons. Peptides. 2012 Mar;34(1):19-25. |