PeptideDB

Human β-defensin-2

CAS: 372146-20-8 F: C188H305N55O50S6 W: 4328.20

Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of epithelial cells.Human β-defensin-2 has antimicrobial activity against gram-negative bacteria and Candida, but not gram-positive Staphylococcus aureus[1]. Human β-defensin-2 can be used for the study of colitis[2].
Name Human β-defensin-2
CAS 372146-20-8
Sequence Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro (Disulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38)
Shortening GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP (Disulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38)
Formula C188H305N55O50S6
Molar Mass 4328.20
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.