| Bioactivity | Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of epithelial cells.Human β-defensin-2 has antimicrobial activity against gram-negative bacteria and Candida, but not gram-positive Staphylococcus aureus[1]. Human β-defensin-2 can be used for the study of colitis[2]. |
| Name | Human β-defensin-2 |
| CAS | 372146-20-8 |
| Sequence | Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro (Disulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38) |
| Shortening | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP (Disulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38) |
| Formula | C188H305N55O50S6 |
| Molar Mass | 4328.20 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Human β-defensin-2
CAS: 372146-20-8 F: C188H305N55O50S6 W: 4328.20
Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.