Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide_product_DataBase

CAS: F: C165H252N44O48S W: 3652.10

Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide is a biotin labeled glucagon-like peptide-1-(7-36). Glucagon-like

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide is a biotin labeled glucagon-like peptide-1-(7-36). Glucagon-like peptide-1-(7-36) is a gastrointestinal peptide with antidiabetogenic activity, and can increase the release of insulin[1][2].
Name	Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide
Shortening	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-{Biotin-Lys}-NH2
Formula	C165H252N44O48S
Molar Mass	3652.10
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.

PeptideDB