| Bioactivity | Human Growth Hormone (1-43) is an N-terminal fragment of human growth hormone with specific and pronounced insulin-like activity. Human Growth Hormone (1-43) can be used to study the function and metabolic pathways of growth hormone, a potential obesity-related factor[1]. |
| Name | Human Growth Hormone (1-43) |
| CAS | 96827-07-5 |
| Sequence | Phe-Pro-Thr-Ile-Pro-Leu-Ser-Arg-Leu-Phe-Asp-Asn-Ala-Met-Leu-Arg-Ala-His-Arg-Leu-His-Gln-Leu-Ala-Phe-Asp-Thr-Tyr-Gln-Glu-Phe-Glu-Glu-Ala-Tyr-Ile-Pro-Lys-Glu-Gln-Lys-Tyr-Ser |
| Shortening | FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS |
| Formula | C240H358N62O67S |
| Molar Mass | 5215.85 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Human Growth Hormone (1-43)
CAS: 96827-07-5 F: C240H358N62O67S W: 5215.85
Human Growth Hormone (1-43) is an N-terminal fragment of human growth hormone with specific and pronounced insulin-like
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.