PeptideDB

Hongotoxin-1

CAS: F: C181H299N53O49S7 W: 4226.13

Hongotoxin-1, isolated from venom of Centruroides limbatus, is the inhibitor of potassium channel, with IC50 for? Kv1.1,
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Hongotoxin-1, isolated from venom of Centruroides limbatus, is the inhibitor of potassium channel, with IC50 for? Kv1.1, Kv1.2, Kv1.3, and Kv1.6 of 31 pM, 170 pM, 86 pM,and 6000 pM, respectively[1].
Name Hongotoxin-1
Sequence Thr-Val-Ile-Asp-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Ile-Arg-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His (Disulfide bridge:Cys3-Cys17;Cys10-Cys21;Cys16-Cys32)
Shortening TVIDVKCTSPKQCLPPCKAQFGIRAGAKCMNGKCKCYPH (Disulfide bridge:Cys3-Cys17;Cys10-Cys21;Cys16-Cys32)
Formula C181H299N53O49S7
Molar Mass 4226.13
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Koschak A, et al. Subunit composition of brain voltage-gated potassium channels determined by hongotoxin-1, a novel peptide derived from Centruroides limbatus venom. The Journal of Biological Chemistry. 273 (5): 2639–44.