| Bioactivity | Hispidalin is a novel antimicrobial peptide with broad and efficient antibacterial activity against various bacterial and fungal pathogens, and can be used as an antibacterial agent and food preservative[1]. |
| Name | Hispidalin |
| CAS | 2243219-67-0 |
| Sequence | Ser-Asp-Tyr-Leu-Asn-Asn-Asn-Pro-Leu-Phe-Pro-Arg-Tyr-Asp-Ile-Gly-Asn-Val-Glu-Leu-Ser-Thr-Ala-Tyr-Arg-Ser-Phe-Ala-Asn-Gln-Lys-Ala-Pro-Gly-Arg-Leu-Asn-Gln-Asn-Trp-Ala-Leu-Thr-Ala-Asp-Tyr-Thr-Tyr-Arg |
| Shortening | SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR |
| Formula | C255H378N72O78 |
| Molar Mass | 5700.17 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |