| Bioactivity | Hexokinase II VDAC binding domain peptide (Hxk2VBD peptide) is a cell-permeable hexokinase II VDAC binding domain. Hexokinase II VDAC binding domain peptide inhibits mitochondrial localization of hexokinase 2 (HXK2). Hexokinase II VDAC binding domain peptide inhibits neurotrophic factor-directed axon outgrowth[1]. |
| Name | Hexokinase II VDAC binding domain peptide |
| Sequence | Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Ile-Ala-Ser-His-Leu-Leu-Ala-Tyr-Phe-Phe-Thr-Glu-Leu-Asn |
| Shortening | RQIKIWFQNRRMKWKKMIASHLLAYFFTELN |
| Formula | C188H290N52O41S2 |
| Molar Mass | 3998.77 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Sun J, et al. aFGF alleviates diabetic endothelial dysfunction by decreasing oxidative stress via Wnt/β-catenin-mediated upregulation of HXK2. Redox Biol. 2021 Feb;39:101811. |
Hexokinase II VDAC binding domain peptide
CAS: F: C188H290N52O41S2 W: 3998.77
Hexokinase II VDAC binding domain peptide (Hxk2VBD peptide) is a cell-permeable hexokinase II VDAC binding domain. Hexok
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.