PeptideDB

Heteropodatoxin-2 TFA

CAS: F: C144H207N39O46S6.xC2HF3O2 W: 3412.81 (free base)

Heteropodatoxin-2 (TFA), a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expre
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Heteropodatoxin-2 (TFA), a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials[1].
Name Heteropodatoxin-2 TFA
Sequence Asp-Asp-Cys-Gly-Lys-Leu-Phe-Ser-Gly-Cys-Asp-Thr-Asn-Ala-Asp-Cys-Cys-Glu-Gly-Tyr-Val-Cys-Arg-Leu-Trp-Cys-Lys-Leu-Asp-Trp-NH2 (Disulfide bridge:Cys3-Cys17;Cys10-Cys22;Cys16-Cys26)
Shortening DDCGKLFSGCDTNADCCEGYVCRLWCKLDW-NH2 (Disulfide bridge:Cys3-Cys17;Cys10-Cys22;Cys16-Cys26)
Formula C144H207N39O46S6.xC2HF3O2
Molar Mass 3412.81 (free base)
Appearance 固体
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Reference [1]. M C Sanguinetti, et al. Heteropodatoxins: peptides isolated from spider venom that block Kv4.2 potassium channels. Mol Pharmacol. 1997 Mar;51(3):491-8.