| Bioactivity | Helospectin II is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin II has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin II is originally isolated from the salivary gland venom of the lizard Heloderma suspectum[1][2]. |
| Invitro | Helospectin II (suffusion at 0.1 nM, in bicarbonate buffer for 30 min) evokes significant, sustained and similar vasodilation in the intact hamster cheek pouch[1].Helospectin II relaxes the Phenylephrine-contracted rat femoral arteries with pEC50 of 6.93[2]. |
| Name | Helospectin II |
| CAS | 93585-83-2 |
| Shortening | HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS |
| Formula | C180H288N46O57 |
| Molar Mass | 4008.55 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Helospectin II
CAS: 93585-83-2 F: C180H288N46O57 W: 4008.55
Helospectin II is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin II has vasodilatory and
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.