PeptideDB

Helospectin II

CAS: 93585-83-2 F: C180H288N46O57 W: 4008.55

Helospectin II is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin II has vasodilatory and
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Helospectin II is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin II has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin II is originally isolated from the salivary gland venom of the lizard Heloderma suspectum[1][2].
Invitro Helospectin II (suffusion at 0.1 nM, in bicarbonate buffer for 30 min) evokes significant, sustained and similar vasodilation in the intact hamster cheek pouch[1].Helospectin II relaxes the Phenylephrine-contracted rat femoral arteries with pEC50 of 6.93[2].
Name Helospectin II
CAS 93585-83-2
Shortening HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS
Formula C180H288N46O57
Molar Mass 4008.55
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.