| Bioactivity | Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum[1][2]. |
| Invitro | Helospectin I (suffusion at 0.1 nM, in bicarbonate buffer for 30 min) evokes significant, sustained and similar vasodilation in the intact hamster cheek pouch[1].Helospectin I relaxes the Phenylephrine-contracted rat femoral arteries with pEC50 of 6.82[2].Helospectin I (0.1 nM-1 μM) inhibits the binding of 125I-labeled VIP and 125I-secretin to dispersed chief cells[4]. |
| Name | Helospectin I |
| CAS | 93438-37-0 |
| Shortening | HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS |
| Formula | C183H293N47O59 |
| Molar Mass | 4095.63 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Helospectin I
CAS: 93438-37-0 F: C183H293N47O59 W: 4095.63
Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and an
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.