| Bioactivity | Heliomicin is an antimicrobial peptide from Heliothis Virescens[1]. |
| Name | Heliomicin |
| CAS | 391977-03-0 |
| Sequence | Asp-Lys-Leu-Ile-Gly-Ser-Cys-Val-Trp-Gly-Ala-Val-Asn-Tyr-Thr-Ser-Asp-Cys-Asn-Gly-Glu-Cys-Lys-Arg-Arg-Gly-Tyr-Lys-Gly-Gly-His-Cys-Gly-Ser-Phe-Ala-Asn-Val-Asn-Cys-Trp-Cys-Glu-Thr |
| Shortening | DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET |
| Formula | C201H303N61O64S6 |
| Molar Mass | 4790.32 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Lamberty M, et al. Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities. Biochemistry. 2001 Oct 9;40(40):11995-2003. |