| Bioactivity | Hainantoxin-IV is a specific antagonist of Sodium Channel, targeting to tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels. His28 and Lys32 are the key resiudes of Hainantoxin-IV for binding with target, while Hainantoxin-IV adopts an inhibitor cystine knot motif[1]. |
| Name | Hainantoxin-IV |
| CAS | 651782-02-4 |
| Sequence | Glu-Cys-Leu-Gly-Phe-Gly-Lys-Gly-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Asn-Leu-Val-Cys-Ser-Arg-Lys-His-Arg-Trp-Cys-Lys-Tyr-Glu-Ile-NH2 (Disulfide bridge: Cys2-Cys17; Cys9-Cys24; Cys16-Cys31) |
| Shortening | ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH2 (Disulfide bridge: Cys2-Cys17; Cys9-Cys24; Cys16-Cys31) |
| Formula | C166H257N53O50S6 |
| Molar Mass | 3987.53 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Liu Y, et al. A positively charged surface patch is important for hainantoxin-IV binding to voltage-gated sodium channels. J Pept Sci. 2012 Oct;18(10):643-9. |
Hainantoxin-IV
CAS: 651782-02-4 F: C166H257N53O50S6 W: 3987.53
Hainantoxin-IV is a specific antagonist of Sodium Channel, targeting to tetrodotoxin-sensitive (TTX-S) voltage-gated sod
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.