| Bioactivity | HG1 Toxin is a peptide found in the venom of the scorpion Heterometrus fulvipes, which has the activity of inhibiting potassium channel Kv1.3. HG1 Toxin also has the activity of inhibiting trypsin (Ki=107 nM) and can be used in the study of autoimmune diseases[1]. |
| Sequence | Gly-His-His-Asn-Arg-Val-Asn-Cys-Leu-Leu-Pro-Pro-Lys-Thr-Gly-Pro-Cys-Lys-Gly-Ser-Phe-Ala-Arg-Tyr-Tyr-Phe-Asp-Ile-Glu-Thr-Gly-Ser-Cys-Lys-Ala-Phe-Ile-Tyr-Gly-Gly-Cys-Glu-Gly-Asn-Ser-Asn-{Asn(GlcNAc)}-Phe-Ser-Glu-Lys-His-His-Cys-Glu-Lys-Arg-Cys-Arg-Gly-Phe-Arg-Lys-Phe-Gly-Gly-Lys (disulfide bridge: Cys8-Cys58;Cys17-Cys54;Cys33-Cys41) |
| Shortening | GHHNRVNCLLPPKTGPCKGSFARYYFDIETGSCKAFIYGGCEGNSN-{Asn(GlcNAc)}-FSEKHHCEKRCRGFRKFGGK (disulfide bridge: Cys8-Cys58;Cys17-Cys54;Cys33-Cys41) |
| Formula | C337H503N103O97S6 |
| Molar Mass | 7741.62 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. ZongYun Chen, et al. Hg1, novel peptide inhibitor specific for Kv1. 3 channels from first scorpion Kunitz-type potassium channel toxin family. Journal of biological chemistry 287.17 (2012): 13813-13821. |