| Bioactivity | HBA(111-142), an antimicrobial peptide, is a C-terminal 32-mer fragment of alpha-hemoglobin. HBA(111-142) has antibacterial activity against the ESKAPE panel of pathogens. HBA(111-142) forms amyloid fibrils, and has antiviral activities. HBA(111-142) inhibits measles and herpes viruses (HSV-1, HSV-2, HCMV)[1]. |
| Name | HBA(111–142) |
| Sequence | Ala-Ala-His-Leu-Pro-Ala-Glu-Phe-Thr-Pro-Ala-Val-His-Ala-Ser-Leu-Asp-Lys-Phe-Leu-Ala-Ser-Val-Ser-Thr-Val-Leu-Thr-Ser-Lys-Tyr-Arg |
| Shortening | AAHLPAEFTPAVHASLDKFLASVSTVLTSKYR |
| Formula | C157H247N41O45 |
| Molar Mass | 3428.89 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Olari LR,et al. The C-terminal 32-mer fragment of hemoglobin alpha is an amyloidogenic peptide with antimicrobial properties. Cell Mol Life Sci. 2023 May 17;80(6):151. |