PeptideDB

GsAF-1

CAS: 518309-03-0 F: C160H245N47O41S7 W: 3707.40

GsAF-1 is a peptide toxin containing three disulfide bonds. GsAF-1 can be isolated from the venom of the Chilean pink ta
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity GsAF-1 is a peptide toxin containing three disulfide bonds. GsAF-1 can be isolated from the venom of the Chilean pink tarantula. GsAF-1 can be used for research of moderate-to-severe pain[1].
Name GsAF-1
CAS 518309-03-0
Sequence Tyr-Cys-Gln-Lys-Trp-Leu-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Asp-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Arg-Leu-NH2
Shortening YCQKWLWTCDSERKCCEDMVCRLWCKKRL-NH2 (Disulfide bonds:Cys2-Cys16, Cys9-Cys21, Cys15-Cys25)
Formula C160H245N47O41S7
Molar Mass 3707.40
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Rong-qiang Liu, et al. Synthesis and Characterization of the Pain-Killing Peptide Grammostola spatulata Analgesic Factor (GsAF-1) Containing Three Disulfide Bonds. Peptides: The Wave of the Future. American Peptide Symposia, vol 7. Springer, Dordrecht.