| Bioactivity | GsAF-1 is a peptide toxin containing three disulfide bonds. GsAF-1 can be isolated from the venom of the Chilean pink tarantula. GsAF-1 can be used for research of moderate-to-severe pain[1]. |
| Name | GsAF-1 |
| CAS | 518309-03-0 |
| Sequence | Tyr-Cys-Gln-Lys-Trp-Leu-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Asp-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Arg-Leu-NH2 |
| Shortening | YCQKWLWTCDSERKCCEDMVCRLWCKKRL-NH2 (Disulfide bonds：Cys2-Cys16, Cys9-Cys21, Cys15-Cys25) |
| Formula | C160H245N47O41S7 |
| Molar Mass | 3707.40 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Rong-qiang Liu, et al. Synthesis and Characterization of the Pain-Killing Peptide Grammostola spatulata Analgesic Factor (GsAF-1) Containing Three Disulfide Bonds. Peptides: The Wave of the Future. American Peptide Symposia, vol 7. Springer, Dordrecht. |
GsAF-1
CAS: 518309-03-0 F: C160H245N47O41S7 W: 3707.40
GsAF-1 is a peptide toxin containing three disulfide bonds. GsAF-1 can be isolated from the venom of the Chilean pink ta
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.