PeptideDB

Glucagon-like peptide 1 (1-37), human

CAS: 87805-34-3 F: C186H275N51O59 W: 4169.48

Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.
Invitro Glucagon-like peptide-1 (GLP-1) is produced by the posttranslational processing of proglucagon and acts as a regulator of various homeostatic events. GLP-1(1-37) is more stable than GLP-1(7-37), with 94.7% of the initial amount of peptide left after a 4h exposure to mouse serum. GLP-1(1-37) is confirmed to be a highly potent agonist of the GLP-1 receptor (GLP-1R) by measuring the expression of the luciferase reporter gene expression in transiently transfected human embryonic kidney (HEK293) cells[1].
Name Glucagon-like peptide 1 (1-37), human
CAS 87805-34-3
Sequence His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
Shortening HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Formula C186H275N51O59
Molar Mass 4169.48
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.