| Bioactivity | Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor. |
| Invitro | Glucagon-like peptide-1 (GLP-1) is produced by the posttranslational processing of proglucagon and acts as a regulator of various homeostatic events. GLP-1(1-37) is more stable than GLP-1(7-37), with 94.7% of the initial amount of peptide left after a 4h exposure to mouse serum. GLP-1(1-37) is confirmed to be a highly potent agonist of the GLP-1 receptor (GLP-1R) by measuring the expression of the luciferase reporter gene expression in transiently transfected human embryonic kidney (HEK293) cells[1]. |
| Name | Glucagon-like peptide 1 (1-37), human |
| CAS | 87805-34-3 |
| Sequence | His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
| Shortening | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Formula | C186H275N51O59 |
| Molar Mass | 4169.48 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |