| Bioactivity | Glucagon-like peptide 1 (1-37), human (TFA) is a highly potent agonist of the GLP-1 receptor. | ||||||
| Invitro | Glucagon-like peptide-1 (GLP-1) is produced by the posttranslational processing of proglucagon and acts as a regulator of various homeostatic events. GLP-1(1-37) is more stable than GLP-1(7-37), with 94.7% of the initial amount of peptide left after a 4h exposure to mouse serum. GLP-1(1-37) is confirmed to be a highly potent agonist of the GLP-1 receptor (GLP-1R) by measuring the expression of the luciferase reporter gene expression in transiently transfected human embryonic kidney (HEK293) cells[1]. | ||||||
| Name | Glucagon-like peptide 1 (1-37), human TFA | ||||||
| Sequence | His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly | ||||||
| Shortening | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG | ||||||
| Formula | C188H276N51F3O61 | ||||||
| Molar Mass | 4283.50 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |
Glucagon-like peptide 1 (1-37), human TFA
CAS: F: C188H276N51F3O61 W: 4283.50
Glucagon-like peptide 1 (1-37), human (TFA) is a highly potent agonist of the GLP-1 receptor.
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.