| Bioactivity | GluN1 (356-385) is an antigenic peptide againstN-methyl-D-aspartate receptor (NMDAR) encephalitis. GluN1 (356-385) has theeffect of reducing the density of surface NMDAR clusters in hippocampalneurons. GluN1 (356-385) can be used to study the pathogenesis of anti-NMDARencephalitis [1]. |
| Name | GluN1(356-385) |
| Sequence | Leu-Gln-Asn-Arg-Lys-Leu-Val-Gln-Val-Gly-Ile-Tyr-Asn-Gly-Thr-His-Val-Ile-Pro-Asn-Asp-Arg-Lys-Ile-Ile-Trp-Pro-Gly-Gly-Glu |
| Shortening | LQNRKLVQVGIYNGTHVIPNDRKIIWPGGE |
| Formula | C154H248N46O42 |
| Molar Mass | 3415.90 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Ding Y, Zhou Z, Chen J, Peng Y, Wang H, Qiu W, Xie W, Zhang J, Wang H. Anti-NMDAR encephalitis induced in mice by active immunization with a peptide from the amino-terminal domain of the GluN1 subunit. J Neuroinflammation. 2021 Feb 21;18(1):53. |