| Bioactivity | Glp-Amyloid-β (3-40) Peptide (human) (AβpE3-40) is a minor amounts of pyroglutamate-modified Aβ isolated from from 24-month-old Amyloid precursor protein (APP) transgenic Mice[1]. |
| Name | Glp-amyloid-β (3-40) peptide (human) |
| CAS | 161818-04-8 |
| Sequence | {Pyr}-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
| Shortening | {Pyr}-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Formula | C187H283N51O53S |
| Molar Mass | 4125.62 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Schieb H, et al. Beta-amyloid peptide variants in brains and cerebrospinal fluid from amyloid precursor protein (APP) transgenic mice: comparison with human Alzheimer amyloid. J Biol Chem. 2011;286(39):33747-33758. |
Glp-amyloid-β (3-40) peptide (human)
CAS: 161818-04-8 F: C187H283N51O53S W: 4125.62
Glp-Amyloid-β (3-40) Peptide (human) (AβpE3-40) is a minor amounts of pyroglutamate-modified Aβ isolated from from 24
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.