PeptideDB

Gastric Inhibitory Peptide, porcine

CAS: 11063-17-5 F: C225H342N60O66S W: 4975.55

Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hor
Sales Email：peptidedb@qq.com
Contact QiTai

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism[1].
Name Gastric Inhibitory Peptide, porcine
CAS 11063-17-5
Shortening YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Formula C225H342N60O66S
Molar Mass 4975.55
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

BDC2.5 mimotope 1040-31

Z-D-Asp-OH

Product Recommendation

Latest release

Hot list

Copyright © 2025 PeptideDB All Rights Reserved

Sitemaps | Contact

Is for research use only, not for human use. We do not sell to patients.