| Bioactivity | Gallin is an antimicrobial peptide derived from egg whites. Gallin inhibits the growth of Escherischia coli at 0.25 μM concentration[1]. |
| Name | Gallin |
| Sequence | Leu-Val-Leu-Lys-Tyr-Cys-Pro-Lys-Ile-Gly-Tyr-Cys-Ser-Asn-Thr-Cys-Ser-Lys-Thr-Gln-Ile-Trp-Ala-Thr-Ser-His-Gly-Cys-Lys-Met-Tyr-Cys-Cys-Leu-Pro-Ala-Ser-Trp-Lys-Trp-Lys (Disulfide bridge:Cys4-Cys10;Cys5-Cys18) |
| Shortening | LVLKYCPKIGYCSNTCSKTQIWATSHGCKMYCCLPASWKWK (Disulfide bridge:Cys4-Cys10;Cys5-Cys18) |
| Formula | C213H320N54O54S7 |
| Molar Mass | 4725.60 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Gong D, et al. Gallin; an antimicrobial peptide member of a new avian defensin family, the ovodefensins, has been subject to recent gene duplication. BMC Immunol. 2010 Mar 12;11:12. |