| Bioactivity | Galanin message associated peptide (1-41) amide is a peptide hormone[1]. |
| Name | Galanin message associated peptide (1-41) amide |
| CAS | 132699-74-2 |
| Sequence | Glu-Leu-Glu-Pro-Glu-Asp-Glu-Ala-Arg-Pro-Gly-Gly-Phe-Asp-Arg-Leu-Gln-Ser-Glu-Asp-Lys-Ala-Ile-Arg-Thr-Ile-Met-Glu-Phe-Leu-Ala-Phe-Leu-His-Leu-Lys-Glu-Ala-Gly-Ala-Leu-NH2 |
| Shortening | ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH2 |
| Formula | C206H326N56O64S |
| Molar Mass | 4643.19 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Helmut G Hinghofer-Szalkay, et al. Circulatory galanin levels increase severalfold with intense orthostatic challenge in healthy humans. J Appl Physiol (1985). 2006 Mar;100(3):844-9. |