| Bioactivity | Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1]. | ||||||
| Name | Galanin (swine) | ||||||
| CAS | 88813-36-9 | ||||||
| Sequence | Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2 | ||||||
| Shortening | GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 | ||||||
| Formula | C146H213N43O40 | ||||||
| Molar Mass | 3210.52 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
Galanin (swine)
CAS: 88813-36-9 F: C146H213N43O40 W: 3210.52
Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine)
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.