| Bioactivity | Galanin (swine) TFA, a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) TFA is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1]. |
| Name | Galanin (swine) (TFA) |
| Sequence | Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2 |
| Shortening | GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 |
| Formula | C148H214F3N43O42 |
| Molar Mass | 3324.54 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Branchek TA, et al. Galanin receptor subtypes. Trends Pharmacol Sci. 2000;21(3):109-117. [2]. Ahrén B, et al. Galanin and the endocrine pancreas. FEBS Lett. 1988;229(2):233-237. |
Galanin (swine) (TFA)
CAS: F: C148H214F3N43O42 W: 3324.54
Galanin (swine) TFA, a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swi
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.