PeptideDB

Galanin (2-29) (rat)

CAS: 141696-11-9 F: C139H208N42O40 W: 3107.40

Galanin (2-29) (rat) inhibits rat pancreatic protein and CCK-8-stimulated amylase secretion. Galanin (2-29) (rat) is an
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Galanin (2-29) (rat) inhibits rat pancreatic protein and CCK-8-stimulated amylase secretion. Galanin (2-29) (rat) is an GAL2R agonist (Ki: 3.5 nM)[1][2].
Name Galanin (2-29) (rat)
CAS 141696-11-9
Sequence Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
Shortening WTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
Formula C139H208N42O40
Molar Mass 3107.40
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Rossowski WJ, et al. Galanin: structure-dependent effect on pancreatic amylase secretion and jejunal strip contraction. Eur J Pharmacol. 1993 Aug 24;240(2-3):259-67. [2]. Wang S, et al. Molecular cloning and pharmacological characterization of a new galanin receptor subtype. Mol Pharmacol. 1997 Sep;52(3):337-43.