| Bioactivity | GTx1-15 is an inhibitor cystine knot (ICK) peptide that inhibits the voltage-dependent calcium channel Cav3.1 and the voltage-dependent sodium channels Nav1.3 and Nav1.7[1]. |
| Name | GTx1-15 |
| Sequence | Asp-Cys-Leu-Gly-Phe-Met-Arg-Lys-Cys-Ile-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Arg-Pro-Asn-Leu-Val-Cys-Ser-Arg-Thr-His-Lys-Trp-Cys-Lys-Tyr-Val-Phe-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30) |
| Shortening | DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30) |
| Formula | C176H271N53O45S7 |
| Molar Mass | 4073.82 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Tadashi Kimura. Stability and Safety of Inhibitor Cystine Knot Peptide, GTx1-15, from the Tarantula Spider Grammostola rosea. Toxins (Basel). 2021 Sep 3;13(9):621. |