| Bioactivity | GRPP (human) is a 30 amino acid Gcg-derived peptide. GRPP (human) causes slight increases in plasma insulin and decreases in plasma glucagon. GRPP (human) does not affect insulin secretion in rat islets[1]. |
| Name | GRPP (human) |
| CAS | 1132745-52-8 |
| Sequence | Arg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp |
| Shortening | RSLQDTEEKSRSFSASQADPLSDPDQMNED |
| Formula | C136H215N41O58S |
| Molar Mass | 3384.47 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Lynda Whiting, et al. Glicentin-related pancreatic polypeptide inhibits glucose-stimulated insulin secretion from the isolated pancreas of adult male rats. Physiol Rep. 2015 Dec;3(12):e12638. |
GRPP (human)
CAS: 1132745-52-8 F: C136H215N41O58S W: 3384.47
GRPP (human) is a 30 amino acid Gcg-derived peptide. GRPP (human) causes slight increases in plasma insulin and decrease
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.