PeptideDB

GRP (porcine)

CAS: 74815-57-9 F: C126H198N38O31S2 W: 2805.29

GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porci
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in many tumors[1][2].
Name GRP (porcine)
CAS 74815-57-9
Sequence Ala-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
Shortening APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2
Formula C126H198N38O31S2
Molar Mass 2805.29
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. McDonald TJ, et al. The effect of gastrin-releasing peptide on the endocrine pancreas. Ann N Y Acad Sci. 1988;547:242-54. [2]. Bostwick DG, Bensch KG. Gastrin releasing peptide in human neuroendocrine tumours. J Pathol. 1985 Dec;147(4):237-44.