| Bioactivity | GRF (1-29) amide (rat) is a synthetic peptide which can stimulate the growth hormone (GH) secretion. | ||||||
| Name | GRF (1-29) amide (rat) | ||||||
| CAS | 91826-20-9 | ||||||
| Sequence | His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-NH2 | ||||||
| Shortening | HADAIFTSSYRRILGQLYARKLLHEIMNR-NH2 | ||||||
| Formula | C155H251N49O40S | ||||||
| Molar Mass | 3473.08 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
GRF (1-29) amide (rat)
CAS: 91826-20-9 F: C155H251N49O40S W: 3473.08
GRF (1-29) amide (rat) is a synthetic peptide which can stimulate the growth hormone (GH) secretion.
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.