| Bioactivity | GLP-2 (1-34) (human) is a polypeptide released from the intestine within minutes after food intake. GLP-2 (1-34) (human) can be used for the research of bone remodeling processes[1]. |
| Name | GLP-2 (1-34) (human) |
| CAS | 99120-49-7 |
| Sequence | His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg |
| Shortening | HADGSFSDEMNTILDNLAARDFINWLIQTKITDR |
| Formula | C171H266N48O56S |
| Molar Mass | 3922.29 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Henriksen DB, et al. Disassociation of bone resorption and formation by GLP-2: a 14-day study in healthy postmenopausal women. Bone. 2007 Mar;40(3):723-9. |
GLP-2 (1-34) (human)
CAS: 99120-49-7 F: C171H266N48O56S W: 3922.29
GLP-2 (1-34) (human) is a polypeptide released from the intestine within minutes after food intake. GLP-2 (1-34) (human)
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.