PeptideDB

GLP-2 (1-34) (human)

CAS: 99120-49-7 F: C171H266N48O56S W: 3922.29

GLP-2 (1-34) (human) is a polypeptide released from the intestine within minutes after food intake. GLP-2 (1-34) (human)
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity GLP-2 (1-34) (human) is a polypeptide released from the intestine within minutes after food intake. GLP-2 (1-34) (human) can be used for the research of bone remodeling processes[1].
Name GLP-2 (1-34) (human)
CAS 99120-49-7
Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg
Shortening HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Formula C171H266N48O56S
Molar Mass 3922.29
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Henriksen DB, et al. Disassociation of bone resorption and formation by GLP-2: a 14-day study in healthy postmenopausal women. Bone. 2007 Mar;40(3):723-9.