| Bioactivity | GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR)[1][2]. |
| Name | GLP-2(rat) |
| CAS | 195262-56-7 |
| Sequence | His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
| Shortening | HADGSFSDEMNTILDNLATRDFINWLIQTKITD |
| Formula | C166H256N44O56S |
| Molar Mass | 3796.14 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
GLP-2(rat)
CAS: 195262-56-7 F: C166H256N44O56S W: 3796.14
GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) e
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.