| Bioactivity | GLP-2(rat) TFA is an intestinal growth factor. GLP-2(rat) TFA stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) TFA enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR)[1][2]. |
| Name | GLP-2(rat) TFA |
| Sequence | His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
| Shortening | HADGSFSDEMNTILDNLATRDFINWLIQTKITD |
| Formula | C168H257F3N44O58S |
| Molar Mass | 3910.16 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
GLP-2(rat) TFA
CAS: F: C168H257F3N44O58S W: 3910.16
GLP-2(rat) TFA is an intestinal growth factor. GLP-2(rat) TFA stimulates cell proliferation and inhibits apoptosis. GLP-
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.