| Bioactivity | GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) is a biotinylated GLP-1 fragment, corresponding to the 7-36 sequence of GLP-1. |
| Name | GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) |
| CAS | 1802086-70-9 |
| Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-{Lys(Biotinyl)}-NH2 |
| Shortening | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-{Lys(Biotinyl)}-NH2 |
| Formula | C165H252N44O48S |
| Molar Mass | 3652.10 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat)
CAS: 1802086-70-9 F: C165H252N44O48S W: 3652.10
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) is a biotinylated GLP-1 fragment, corresponding
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.