| Bioactivity | GIP (mouse) is a gastrointestinal hormone that is expressed in and secreted from the pancreatic islets and promotes insulin secretion[1]. |
| CAS | 181591-59-3 |
| Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Arg-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
| Shortening | YAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ |
| Formula | C225H342N62O66S |
| Molar Mass | 5003.56 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Yukihiro Fujita, et al. Glucose-dependent insulinotropic polypeptide is expressed in pancreatic islet alpha-cells and promotes insulin secretion. Gastroenterology. 2010 May;138(5):1966-75. |
GIP (mouse)
CAS: 181591-59-3 F: C225H342N62O66S W: 5003.56
GIP (mouse) is a gastrointestinal hormone that is expressed in and secreted from the pancreatic islets and promotes insu
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.