PeptideDB

GIP (mouse)

CAS: 181591-59-3 F: C225H342N62O66S W: 5003.56

GIP (mouse) is a gastrointestinal hormone that is expressed in and secreted from the pancreatic islets and promotes insu
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity GIP (mouse) is a gastrointestinal hormone that is expressed in and secreted from the pancreatic islets and promotes insulin secretion[1].
CAS 181591-59-3
Sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Arg-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
Shortening YAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ
Formula C225H342N62O66S
Molar Mass 5003.56
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Yukihiro Fujita, et al. Glucose-dependent insulinotropic polypeptide is expressed in pancreatic islet alpha-cells and promotes insulin secretion. Gastroenterology. 2010 May;138(5):1966-75.