PeptideDB

GIP (1-30) amide,human acetate

CAS: F: C164H244N40O49S W: 3591.99

GIP (1-30) amide,human acetate is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin horm
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity GIP (1-30) amide,human acetate is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human acetate dose-dependently promotes insulin secretion over the range 10-9-10-6 M[1].
Invitro The glucose-dependent action of Glucose-dependent insulinotropic polypeptide (GIP) on pancreatic β-cells has attracted attention towards its exploitation as a potential drug for type 2 diabetes. In a 50% aqueous trifluoroethanol solvent, GIP(1-30) amide has an α-helical structural region from F6 to A28. The structures calculated for GIP(1-30) amide remain within one family of conformations and the level of agreement between the structures demonstrated the ordered arrangement[1].
Name GIP (1-30) amide,human acetate
Sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-NH2
Shortening YAEGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2
Formula C164H244N40O49S
Molar Mass 3591.99
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)