| Bioactivity | GIP (1-30) amide,human acetate is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human acetate dose-dependently promotes insulin secretion over the range 10-9-10-6 M[1]. | ||||||
| Invitro | The glucose-dependent action of Glucose-dependent insulinotropic polypeptide (GIP) on pancreatic β-cells has attracted attention towards its exploitation as a potential drug for type 2 diabetes. In a 50% aqueous trifluoroethanol solvent, GIP(1-30) amide has an α-helical structural region from F6 to A28. The structures calculated for GIP(1-30) amide remain within one family of conformations and the level of agreement between the structures demonstrated the ordered arrangement[1]. | ||||||
| Name | GIP (1-30) amide,human acetate | ||||||
| Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-NH2 | ||||||
| Shortening | YAEGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2 | ||||||
| Formula | C164H244N40O49S | ||||||
| Molar Mass | 3591.99 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
GIP (1-30) amide,human acetate
CAS: F: C164H244N40O49S W: 3591.99
GIP (1-30) amide,human acetate is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin horm
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.