| Bioactivity | GIP (1-30) amide, porcine is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42)[1]. GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin. |
| Name | GIP (1-30) amide, porcine |
| CAS | 134846-93-8 |
| Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 |
| Shortening | YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2 |
| Formula | C162H245N41O47S |
| Molar Mass | 3551.00 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
GIP (1-30) amide, porcine
CAS: 134846-93-8 F: C162H245N41O47S W: 3551.00
GIP (1-30) amide, porcine is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affini
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.