| Bioactivity | GIP (1-30) amide, porcine TFA is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42)[1]. GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin. | ||||||
| Name | GIP (1-30) amide, porcine TFA | ||||||
| Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 | ||||||
| Shortening | YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2 | ||||||
| Formula | C164H246F3N41O49S | ||||||
| Molar Mass | 3665.02 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |
GIP (1-30) amide, porcine TFA
CAS: F: C164H246F3N41O49S W: 3665.02
GIP (1-30) amide, porcine TFA is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high af
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.