GIP, rat TFA_product_DataBase

Bioactivity	GIP, rat TFA is a bioactive peptide of rat origin. (GIP (glucose-dependent insulinotropic polypeptide or also known as gastric inhibitory polypeptide) is a 42-amino acid peptide released by K cells in the duodenum and jejunum in response to food intake. GIP and GLP (gastric-like peptide) are both intestinal A member of the insulinotropic hormone peptide family that stimulates insulin secretion from pancreatic beta cells and appears to also promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and may play a role in the pathogenesis of obesity function in the mechanism.
Name	GIP, rat TFA
Sequence	Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln
Shortening	YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Formula	C226H343N61O66S.xC2HF3O2
Molar Mass	5002.58 (free base)
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.

PeptideDB