PeptideDB

GIP, rat TFA

CAS: F: C226H343N61O66S.xC2HF3O2 W: 5002.58 (free base)

GIP, rat TFA is a bioactive peptide of rat origin. (GIP (glucose-dependent insulinotropic polypeptide or also known as g
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity GIP, rat TFA is a bioactive peptide of rat origin. (GIP (glucose-dependent insulinotropic polypeptide or also known as gastric inhibitory polypeptide) is a 42-amino acid peptide released by K cells in the duodenum and jejunum in response to food intake. GIP and GLP (gastric-like peptide) are both intestinal A member of the insulinotropic hormone peptide family that stimulates insulin secretion from pancreatic beta cells and appears to also promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and may play a role in the pathogenesis of obesity function in the mechanism.
Name GIP, rat TFA
Sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln
Shortening YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Formula C226H343N61O66S.xC2HF3O2
Molar Mass 5002.58 (free base)
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.