PeptideDB

GIP, human TFA

CAS: F: C228H339F3N60O68S W: 5097.62

GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion a
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human TFA acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion[1][2][3].
Invitro Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state[1]. GIP, human plays a vital role in lipid metabolism and the development of obesity.
Name GIP, human TFA
Sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
Shortening YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Formula C228H339F3N60O68S
Molar Mass 5097.62
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)