| Bioactivity | GHRF, mouse, a mouse growth hormone-releasing factor, is a peptide containing 44 amino acids. GHRF, mouse stimulates the release and synthesis of growth hormone[1]. |
| Name | GHRF, mouse |
| CAS | 125199-49-7 |
| Shortening | HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS |
| Formula | C220H365N69O64S |
| Molar Mass | 5032.74 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
GHRF, mouse
CAS: 125199-49-7 F: C220H365N69O64S W: 5032.74
GHRF, mouse, a mouse growth hormone-releasing factor, is a peptide containing 44 amino acids. GHRF, mouse stimulates the
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.