| Bioactivity | Fasciculin-I is isolated from the mambas venom. Fasciculin-I exerts its toxic effects by inhibiting acetylcholinesterase (AChE). Fasciculin-I blocks α-neurotoxins of nicotinic acetylcholine receptors and cardiac toxins that interact with cell membranes [1]. |
| Name | Fasciculin-I |
| Sequence | Thr-Met-Cys-Tyr-Ser-His-Thr-Thr-Thr-Ser-Arg-Ala-Ile-Leu-Thr-Asn-Cys-Gly-Glu-Asn-Ser-Cys-Tyr-Arg-Lys-Ser-Arg-Arg-His-Pro-Pro-Lys-Met-Val-Leu-Gly-Arg-Gly-Cys-Gly-Cys-Pro-Pro-Gly-Asp-Asp-Tyr-Leu-Glu-Val-Lys-Cys-Cys-Thr-Ser-Pro-Asp-Lys-Cys-Asn-Tyr (Disulfide bridge:Cys3-Cys22;Cys17-Cys39;Cys41-Cys52;Cys53-Cys59) |
| Shortening | TMCYSHTTTSRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPGDDYLEVKCCTSPDKCNY (Disulfide bridge:Cys3-Cys22;Cys17-Cys39;Cys41-Cys52;Cys53-Cys59) |
| Formula | C281H441N87O90S10 |
| Molar Mass | 6798.69 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. van den Born HK, et al. Theoretical analysis of the structure of the peptide fasciculin and its docking to acetylcholinesterase. Protein Sci. 1995 Apr;4(4):703-15. |