| Bioactivity | FRETS-VWF73 is a biological active peptide. (FRETS-VWF73 is a very powerful Fluorescence-Quenching Substrate for the VWF cleaving protease ADAMTS-13. It is commonly used as a useful tool for the rapid measurement of ADAMTS-13 activity in plasma and is a predictive marker for various thrombotic diseases like TPP. Our new substrate FRETS-VWF73 can be easily used with a 96-well format in commercial plate readers.) |
| Name | FRETS-VWF73 |
| Sequence | H-Asp-Arg-Glu-{Dap(Nma)}-Ala-Pro-Asn-Leu-Val-Tyr-Met-Val-Thr-Gly-{Dap(Dnp)}-Pro-Ala-Ser-Asp-Glu-Ile-Lys-Arg-Leu-Pro-Gly-Asp-Ile-Gln-Val-Val-Pro-Ile-Gly-Val-Gly-Pro-Asn-Ala-Asn-Val-Gln-Glu-Leu-Glu-Arg-Ile-Gly-Trp-Pro-Asn-Ala-Pro-Ile-Leu-Ile-Gln-Asp-Phe-Glu-Thr-Leu-Pro-Arg-Glu-Ala-Pro-Asp-Leu-Val-Leu-Gln-Arg-OH |
| Shortening | DRE-{Dap(Nma)}-APNLVYMVTG-{Dap(Dnp)}-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR |
| Formula | C370H583N103O113S |
| Molar Mass | 8314.28 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |