| Bioactivity | FITC-α-Bungarotoxin is the FITC labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs)[1]. |
| Name | FITC-α-Bungarotoxin |
| Sequence | {FITC}-Ile-Val-Cys-His-Thr-Thr-Ala-Thr-Ser-Pro-Ile-Ser-Ala-Val-Thr-Cys-Pro-Pro-Gly-Glu-Asn-Leu-Cys-Tyr-Arg-Lys-Met-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ser-Arg-Gly-Lys-Val-Val-Glu-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ser-Lys-Lys-Pro-Tyr-Glu-Glu-Val-Thr-Cys-Cys-Ser-Thr-Asp-Lys-Cys-Asn-Pro-His-Pro-Lys-Gln-Arg-Pro-Gly (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65) |
| Shortening | {FITC}-IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65) |
| Formula | C365H551N99O111S12 |
| Molar Mass | 8486.66 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Hannan S, et al. Snake neurotoxin α-bungarotoxin is an antagonist at native GABA(A) receptors. Neuropharmacology. 2015;93:28-40. |