| Bioactivity | Exendin-P5 is a selective agonist that targets the GLP-1R. Exendin-P5 promotes rapid activation of G proteins by transient interactions with the transmembrane domain of GLP-1R, enhancing its potency in G protein-mediated signaling and accelerating cAMP production. This mechanism suggests the potential application of Exendin-P5 in the study of metabolic diseases[1]. |
| Sequence | Glu-Leu-Val-Asp-Asn-Ala-Val-Gly-Gly-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ala |
| Shortening | ELVDNAVGGDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPA |
| Formula | C185H291N49O61S |
| Molar Mass | 4209.65 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Deganutti G, et al. Dynamics of GLP-1R peptide agonist engagement are correlated with kinetics of G protein activation. Nat Commun. 2022 Jan 10;13(1):92. |