| Bioactivity | Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis[1][2]. |
| Name | Exendin-4 (3-39) |
| CAS | 196109-31-6 |
| Shortening | EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Formula | C176H272N46O58S |
| Molar Mass | 3992.44 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Exendin-4 (3-39)
CAS: 196109-31-6 F: C176H272N46O58S W: 3992.44
Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two ami
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.